PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.B03417.3.p
Common NameEUGRSUZ_B03417
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 450aa    MW: 50400.9 Da    PI: 6.0045
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.B03417.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.38.5e-142266348
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       W++eEd++l + +  +G+++W+ Ia+++   +t  qc+ rw++yl
  Eucgr.B03417.3.p 22 TWSQEEDDILREQIGIHGTENWSIIASKFK-DKTTRQCRRRWYTYL 66
                      6****************************9.*************97 PP

2Myb_DNA-binding43.57.3e-1472115146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       +g W++eEd ll +a k +G++ W+ Ia+ +  gRt++ +k+r+ +
  Eucgr.B03417.3.p  72 KGGWSPEEDVLLCEAQKIFGNR-WTEIAKVVS-GRTDNAVKNRFTT 115
                       688*******************.*********.**********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.0771566IPR017930Myb domain
SuperFamilySSF466891.39E-2519113IPR009057Homeodomain-like
SMARTSM007176.2E-131968IPR001005SANT/Myb domain
CDDcd001671.58E-122266No hitNo description
PfamPF139211.9E-142382No hitNo description
Gene3DG3DSA:1.10.10.604.0E-202374IPR009057Homeodomain-like
PROSITE profilePS5129420.58467121IPR017930Myb domain
SMARTSM007178.5E-1571119IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.2E-1975120IPR009057Homeodomain-like
CDDcd001678.99E-1175116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009553Biological Processembryo sac development
GO:0010052Biological Processguard cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 450 aa     Download sequence    Send to blast
MQDMKMTTDT EDSKKKERHI VTWSQEEDDI LREQIGIHGT ENWSIIASKF KDKTTRQCRR  60
RWYTYLNSDF KKGGWSPEED VLLCEAQKIF GNRWTEIAKV VSGRTDNAVK NRFTTLCKKR  120
ARYEALAKEN NTTFITPNSK RIISHNPSSV DRPAESAALA KRMRRAHIQN IAGDCNLKDR  180
LHIQSGITYS QQQRAPFSTL AQNFRTSNSP PQQSESNQKE ATDDAHGTNV QGTFLKKDDP  240
KVTALIQQAE LLSSLAVKVN ADNMDQSLEN AWKVLQEFLS HKKDDDILQD CITDTDLQFE  300
DFKVMVEDLR SSNEGSQTSW RPPDLCEESP ASSEYSTAST ISTHPVYDKA EEPQAEEVAL  360
HKVIETELQT NHSDEQGVVH NCCKGILSSS VTHGGTFQSC DEHVTATGVV SVSSNTECSS  420
PVHVTPLFRS LAAGIPTPKF SESEHLFSA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-272312110108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00259DAPTransfer from AT2G02820Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.B03417.3.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010044718.10.0PREDICTED: uncharacterized protein LOC104433610 isoform X1
TrEMBLA0A059D7W00.0A0A059D7W0_EUCGR; Uncharacterized protein
STRINGVIT_01s0026g01910.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02820.21e-155myb domain protein 88